HBV Large S Protein Antikörper (AA 4-51)

Produktnummer ABIN5708085

Der Kaninchen Polyklonal Anti-HBV Large S Protein-Antikörper wurde für WB und IHC (p) validiert. Er ist geeignet, HBV Large S Protein in Proben von Hepatitis B Virus (HBV) zu detektieren.

Kurzübersicht für HBV Large S Protein Antikörper (AA 4-51) (ABIN5708085)

Target: HBV Large S Protein (L-HBsAG) (Hepatitis B Virus Large Surface Protein (L-HBsAG))

Reaktivität: Hepatitis B Virus (HBV)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HBV Large S Protein Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-HBV Large S Protein Antikörper

Bindungsspezifität: AA 4-51

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 4-51 (WSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQ) from the human HBV Large S protein were used as the immunogen for the Hepatitis B Virus antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the Hepatitis B Virus antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the Hepatitis B Virus antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu HBV Large S Protein

Target: HBV Large S Protein (L-HBsAG) (Hepatitis B Virus Large Surface Protein (L-HBsAG))

Andere Bezeichnung: Hepatitis B Virus (Large S Protein)

Substanzklasse: Viral Protein

Hintergrund: Hepatitis B virus, abbreviated HBV, is a species of the genus Orthohepadnavirus, which is likewise a part of the Hepadnaviridae family of viruses. This virus causes the disease hepatitis B. It consists of HBsAg, HBcAg (HBeAg is a splice variant), Hepatitis B virus DNA polymerase and HBx. Among these, HBsAg (also known as the Australia antigen) is the surface antigen of the hepatitis B virus (HBV). It indicates current hepatitis B infection. The viral envelope of an enveloped virus has different surface proteins from the rest of the virus which act as antigens. These antigens are recognized by antibody proteins that bind specifically to one of these surface proteins.

UniProt: D2X4M3